Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] |
---|
Ligand | BDBM97445 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Kinetics Assay |
---|
pH | 8±0 |
---|
Temperature | 298.15±0 K |
---|
Ki | 15±0 nM |
---|
Citation | Neckles, C; Eltschkner, S; Cummings, JE; Hirschbeck, M; Daryaee, F; Bommineni, GR; Zhang, Z; Spagnuolo, L; Yu, W; Davoodi, S; Slayden, RA; Kisker, C; Tonge, PJ Rationalizing the Binding Kinetics for the Inhibition of the Burkholderia pseudomallei FabI1 Enoyl-ACP Reductase. Biochemistry56:1865-1878 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] |
Synonyms: | Enoyl-ACP reductase (FabI1) |
Type: | Enzyme |
Mol. Mass.: | 27824.56 |
Organism: | Burkholderia pseudomallei |
Description: | Q3JG55 |
Residue: | 253 |
Sequence: | MRLQHKRGLIIGIANENSIAFGCARVMREQGAELALTYLNEKAEPYVRPLAQRLDSRLVV
PCDVREPGRLEDVFARIAQEWGQLDFVLHSIAYAPKEDLHRRVTDCSQAGFAMAMDVSCH
SFIRVARLAEPLMTNGGCLLTVTFYGAERAVEDYNLMGPVKAALEGSVRYLAAELGPRRI
RVHALSPGPLKTRAASGIDRFDALLERVRERTPGHRLVDIDDVGHVAAFLASDDAAALTG
NVEYIDGGYHVVG
|
|
|
BDBM97445 |
---|
n/a |
---|
Name | BDBM97445 |
Synonyms: | PT119 |
Type | Small molecule |
Emp. Form. | C19H21NO2 |
Mol. Mass. | 295.3755 |
SMILES | CCCCCCc1ccc(Oc2ccccc2C#N)c(O)c1 |
Structure |
|