Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM226162 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dihydrofolate Reductase (DHFR) Inhibition Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 7500±590 nM |
---|
Comments | extracted |
---|
Citation | El-Gazzar, YI; Georgey, HH; El-Messery, SM; Ewida, HA; Hassan, GS; Raafat, MM; Ewida, MA; El-Subbagh, HI Synthesis, biological evaluation and molecular modeling study of new (1,2,4-triazole or 1,3,4-thiadiazole)-methylthio-derivatives of quinazolin-4(3H)-one as DHFR inhibitors Bioorg Chem72:282-292 (2017) |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
Type: | Enzyme |
Mol. Mass.: | 21603.71 |
Organism: | Bos taurus (Cattle) |
Description: | P00376 |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
BDBM226162 |
---|
n/a |
---|
Name | BDBM226162 |
Synonyms: | 2-[6-Chloro-3-(4-methoxyphenyl)-4-oxo-3,4-dihydroquinazolin-2-yl-thio] acetohydrazide (14) |
Type | Small organic molecule |
Emp. Form. | C17H15ClN4O3S |
Mol. Mass. | 390.844 |
SMILES | COc1ccc(cc1)-n1c(SCC(=O)NN)nc2ccc(Cl)cc2c1=O |
Structure |
|