Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein 5 [K24A,R33A,K34A] |
---|
Ligand | BDBM228800 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Ligand Binding Assay |
---|
pH | 8.2±n/a |
---|
Temperature | 303.15±n/a K |
---|
Ki | 1.24e+3±n/a nM |
---|
Comments | extracted |
---|
Citation | Armstrong, EH; Goswami, D; Griffin, PR; Noy, N; Ortlund, EA Structural basis for ligand regulation of the fatty acid-binding protein 5, peroxisome proliferator-activated receptor ß/d (FABP5-PPARß/d) signaling pathway. J Biol Chem289:14941-54 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein 5 [K24A,R33A,K34A] |
---|
Name: | Fatty acid-binding protein 5 [K24A,R33A,K34A] |
Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid-binding protein 5 (FABP5)(NLSm) |
Type: | Protein |
Mol. Mass.: | 14962.47 |
Organism: | Homo sapiens (Human) |
Description: | Human FABP5 NLS-deficient mutant (K24A/K34A/R33A) |
Residue: | 135 |
Sequence: | MATVQQLEGRWRLVDSKGFDEYMAELGVGIALAAMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
BDBM228800 |
---|
n/a |
---|
Name | BDBM228800 |
Synonyms: | NOEV | Sapienic acid (SpA) |
Type | Small organic molecule |
Emp. Form. | C15H29NO4 |
Mol. Mass. | 287.3951 |
SMILES | CCCCCCCCN[C@H]1C=C(CO)[C@@H](O)[C@H](O)[C@H]1O |t:10| |
Structure |
|