Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase |
---|
Ligand | BDBM26994 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | CA Inhibition Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 94000±n/a nM |
---|
Comments | extracted |
---|
Citation | Maresca, A; Vullo, D; Scozzafava, A; Supuran, CT Inhibition of the alpha- and beta-carbonic anhydrases from the gastric pathogen Helycobacter pylori with anions. J Enzyme Inhib Med Chem28:388-91 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase |
---|
Name: | Carbonic anhydrase |
Synonyms: | β-Carbonic anhydrase (βCA) |
Type: | Enzyme |
Mol. Mass.: | 25322.60 |
Organism: | Helicobacter pylori |
Description: | Q08IJ2 |
Residue: | 218 |
Sequence: | MKAFLGALEFQENEYEELKELYESLKTKQKPHTLFISCVDSRVVPNLITGTKPGELYVIR
NMGNVIPPKTSHKESLSTMASIEYAIVHVGVQNLIICGHSDCGACGSTHLINDGTKAKTP
YIADWIQFLEPIKEELKNHPQFSNHFAKRSWLTERLNVRLQLNNLLSYDFIQERVVNNEL
KIFGWHYIIETGRIYNYNFESHFFEPIETKQRKSHENF
|
|
|
BDBM26994 |
---|
n/a |
---|
Name | BDBM26994 |
Synonyms: | CHEMBL68253 | H2NSO3H | sulfamic acid |
Type | n/a |
Emp. Form. | H3NO3S |
Mol. Mass. | 97.094 |
SMILES | NS(O)(=O)=O |
Structure |
|