| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM26997 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | CA Inhibition Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 92000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Maresca, A; Vullo, D; Scozzafava, A; Supuran, CT Inhibition of the alpha- and beta-carbonic anhydrases from the gastric pathogen Helycobacter pylori with anions. J Enzyme Inhib Med Chem28:388-91 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | β-Carbonic anhydrase (βCA) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25322.60 |
|---|
| Organism: | Helicobacter pylori |
|---|
| Description: | Q08IJ2 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MKAFLGALEFQENEYEELKELYESLKTKQKPHTLFISCVDSRVVPNLITGTKPGELYVIR
NMGNVIPPKTSHKESLSTMASIEYAIVHVGVQNLIICGHSDCGACGSTHLINDGTKAKTP
YIADWIQFLEPIKEELKNHPQFSNHFAKRSWLTERLNVRLQLNNLLSYDFIQERVVNNEL
KIFGWHYIIETGRIYNYNFESHFFEPIETKQRKSHENF
|
|
|
|---|
| BDBM26997 |
|---|
| n/a |
|---|
| Name | BDBM26997 |
|---|
| Synonyms: | CHEMBL364571 | PhAsO3H2 | benzenarsonic acid | benzenearsonic acid | phenylarsonic acid |
|---|
| Type | n/a |
|---|
| Emp. Form. | C6H7AsO3 |
|---|
| Mol. Mass. | 202.0396 |
|---|
| SMILES | O[As](O)(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
