| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinol-binding protein 4 |
|---|
| Ligand | BDBM249479 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TR-FRET Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 277.15±n/a K |
|---|
| IC50 | 1.618692±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Petrukhin, K; Cioffi, C; Johnson, G; Allikmets, R; Freeman, E; Chen, P; Conlon, M; Zhu, L Substituted 4-phenylpiperidines, their preparation and use US Patent US9434727 Publication Date 9/6/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinol-binding protein 4 |
|---|
| Name: | Retinol-binding protein 4 |
|---|
| Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23008.75 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P02753 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
|---|
| BDBM249479 |
|---|
| n/a |
|---|
| Name | BDBM249479 |
|---|
| Synonyms: | US9434727, 77 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19F4N5O |
|---|
| Mol. Mass. | 421.3914 |
|---|
| SMILES | Fc1cccc(C2CCN(CC2)C(=O)c2n[nH]c3CN(CCc23)C#N)c1C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
