| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Baculoviral IAP repeat-containing protein 2 [174-256] |
|---|
| Ligand | BDBM298436 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Inhibition |
|---|
| IC50 | 8.00±n/a nM |
|---|
| Citation |  Baker, TM; Fyfe, MC; Jones, G; Thom, SM Kinase inhibitors US Patent US10392346 Publication Date 8/27/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Baculoviral IAP repeat-containing protein 2 [174-256] |
|---|
| Name: | Baculoviral IAP repeat-containing protein 2 [174-256] |
|---|
| Synonyms: | API1 | BIRC2 | BIRC2_HUMAN | CIAP Bir2 | MIHB | RNF48 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 9527.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13490[174-256] |
|---|
| Residue: | 83 |
|---|
| Sequence: | TNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPK
DDAMSEHRRHFPNCPFLENSLET
|
|
|
|---|
| BDBM298436 |
|---|
| n/a |
|---|
| Name | BDBM298436 |
|---|
| Synonyms: | 2-(2-(2-(4-((4-((4-(3-(5-(tert-Butyl)-2-methoxy-3-(methylsulfonamido)phenyl)ureido)-naphthalen-1-yl)oxy)pyridin-2-yl)amino)-2-methoxybenzamido)ethoxy)ethoxy)ethyl dihydrogen phosphate | US10125100, Example 19 | US10392346, Example 19 | US10941115, Example 19 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H51N6O13PS |
|---|
| Mol. Mass. | 910.926 |
|---|
| SMILES | COc1cc(Nc2cc(Oc3ccc(NC(=O)Nc4cc(cc(NS(C)(=O)=O)c4OC)C(C)(C)C)c4ccccc34)ccn2)ccc1C(=O)NCCOCCOCCOP(O)(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
