| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-17A |
|---|
| Ligand | BDBM50461082 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | I L-17A Secretion |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Musicki, B; Bouix-Peter, C; Ouvry, G; Thoreau, E Benzenesulfonamide derivatives as inverse agonists of retinoid-related orphan receptor gamma (RORγ(T)) US Patent US10457637 Publication Date 10/29/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-17A |
|---|
| Name: | Interleukin-17A |
|---|
| Synonyms: | CTLA8 | Cytotoxic T-lymphocyte-associated antigen 8 | IL-17 | IL17 | IL17A | IL17_HUMAN | il-17a |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17511.44 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q16552 |
|---|
| Residue: | 155 |
|---|
| Sequence: | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
|
|
|
|---|
| BDBM50461082 |
|---|
| n/a |
|---|
| Name | BDBM50461082 |
|---|
| Synonyms: | CHEMBL4226691 | US10457637, Compound 63 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H36N4O4S2 |
|---|
| Mol. Mass. | 520.708 |
|---|
| SMILES | CCc1ccc(cc1)N(CC(C)C)S(=O)(=O)c1ccc(N2CCN(CC2)C(C)=O)c(c1)S(C)(=N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
