Reaction Details |
| Report a problem with these data |
Target | Baculoviral IAP repeat-containing protein 3 [238-349] |
---|
Ligand | BDBM422073 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Biological Assay 1: affinity of compounds to cIAP1-BIR3, cIAP2-BIR3, XIAP-BIR3 |
---|
IC50 | <10.00±n/a nM |
---|
Citation | Sun, F; Ding, CZ; Cai, Z; Qian, W; Hu, G; Li, J; Chen, S Benzimidazole-linked indole compound acting as novel divalent IAP antagonist US Patent US10508103 Publication Date 12/17/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Baculoviral IAP repeat-containing protein 3 [238-349] |
---|
Name: | Baculoviral IAP repeat-containing protein 3 [238-349] |
Synonyms: | API2 | Apoptosis inhibitor 2 | BIRC3 | BIRC3_HUMAN | Baculoviral IAP repeat-containing protein 3 | HIAP-1 | Inhibitor of apoptosis protein 1 | MIHC | RNF49 | TNFR2-TRAF-signaling complex protein 1 | cIAP-2 BIR3 |
Type: | BIR3 domain |
Mol. Mass.: | 12945.93 |
Organism: | Homo sapiens (Human) |
Description: | Human cIAP2 BIR3 domain (residues 238-349) was used in binding assays. |
Residue: | 112 |
Sequence: | QLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDG
GLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTS
|
|
|
BDBM422073 |
---|
n/a |
---|
Name | BDBM422073 |
Synonyms: | US10508103, Embodiment 26 |
Type | Small organic molecule |
Emp. Form. | C43H57F4N9O4 |
Mol. Mass. | 839.9642 |
SMILES | CC[C@H](NC(=O)[C@H](C)NC)C(=O)N1C[C@@H](F)C[C@H]1Cn1c(nc2cc(F)ccc12)-c1[nH]c2cc(F)ccc2c1C[C@@H]1C[C@H](F)CN1C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| |
Structure |
|