| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Programmed cell death protein 1 |
|---|
| Ligand | BDBM436170 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Homogenous Time-Resolved Fluorescence (HTRF) Binding Assay |
|---|
| IC50 | 5±n/a nM |
|---|
| Citation |  Yeung, K; Grant-Young, KA; Zhu, J; Saulnier, MG; Frennesson, DB; Meng, Z; Scola, PM 1,3-dihydroxy-phenyl derivatives useful as immunomodulators US Patent US10590105 Publication Date 3/17/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Programmed cell death protein 1 |
|---|
| Name: | Programmed cell death protein 1 |
|---|
| Synonyms: | CD_antigen=CD279 | PD1 | PDCD1 | PDCD1_HUMAN | Programmed cell death protein 1 | Protein PD-1 | hPD-1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31650.07 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_108437 |
|---|
| Residue: | 288 |
|---|
| Sequence: | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
|
|
|
|---|
| BDBM436170 |
|---|
| n/a |
|---|
| Name | BDBM436170 |
|---|
| Synonyms: | US10590105, Example 2013 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H48ClN5O6 |
|---|
| Mol. Mass. | 730.292 |
|---|
| SMILES | CCC(CO)(CO)NCc1cc(Cl)c(OCc2nccc(c2C)-c2cccc(OCCCN3CC[C@@H](O)C3)c2C)cc1OCc1cncc(c1)C#N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
