| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Estrogen receptor [307-554] |
|---|
| Ligand | BDBM361498 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| IC50 | 0.650±n/a nM |
|---|
| Citation |  Nissink, JW; Scott, JS; Moss, TA; Hughes, SJ; Barlaam, BC; Yang, B Selective estrogen receptor down-regulators US Patent US10590132 Publication Date 3/17/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Estrogen receptor [307-554] |
|---|
| Name: | Estrogen receptor [307-554] |
|---|
| Synonyms: | ESR | ESR1 | ESR1_HUMAN | Estrogen receptor(ER) (aa 307-554) | NR3A1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 28281.50 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 307-554 |
|---|
| Residue: | 248 |
|---|
| Sequence: | ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPG
FVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFD
MLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTL
IHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDA
HRLHAPTS
|
|
|
|---|
| BDBM361498 |
|---|
| n/a |
|---|
| Name | BDBM361498 |
|---|
| Synonyms: | N1-(2-fluoro- 4-methoxy-3- ((1R,3R)-3- methyl-2- (2,2,2- trifluoroethyl)- 2,3,4,9- tetrahydro-1H- pyrido[3,4- b]indol-1- yl)phenyl)-N2- (3- fluoropropyl) ethane-1,2- diamine | US10221173, Example 90 | US10590132, Example 90 | US11046689, Example 90 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H31F5N4O |
|---|
| Mol. Mass. | 510.5426 |
|---|
| SMILES | COc1ccc(NCCNCCCF)c(F)c1[C@H]1N(CC(F)(F)F)[C@H](C)Cc2c1[nH]c1ccccc21 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
