| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Metallothionein-2 |
|---|
| Ligand | BDBM463444 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| Ki | 0.930±n/a nM |
|---|
| Citation |  Ruch Werneck Guimarães, C; Felype Zaneti De Azevedo, H; Mascarello, A; Watanabe Da Costa, R; Freire Torres Russo, V; Mannochio De Souza Russo, E Compounds, process for obtaining the compounds, pharmaceutical composition, use of the compounds and method for treating psychiatric disorders and/or sleep disorders US Patent US10781182 Publication Date 9/22/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Metallothionein-2 |
|---|
| Name: | Metallothionein-2 |
|---|
| Synonyms: | CES1 | MT-2 | MT-II | MT2 | MT2A | MT2_HUMAN | Metallothionein-2A | Metallothionein-II |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 6046.23 |
|---|
| Organism: | Human |
|---|
| Description: | P02795 |
|---|
| Residue: | 61 |
|---|
| Sequence: | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC
A
|
|
|
|---|
| BDBM463444 |
|---|
| n/a |
|---|
| Name | BDBM463444 |
|---|
| Synonyms: | US10781182, Compound IA2-121 | US11091445, Compound code IA2-121 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H18ClN3O3 |
|---|
| Mol. Mass. | 311.764 |
|---|
| SMILES | CCOc1nc2cc(Cl)c(OC)cc2n1CCNC(C)=O |
|---|
| Structure | 
|
|---|
Search and Browse
