Reaction Details |
| Report a problem with these data |
Target | N-formyl peptide receptor 2 |
---|
Ligand | BDBM350538 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FLIPR |
---|
EC50 | 395000±n/a nM |
---|
Citation | Viswanath, V; Beard, RL; Donello, JE; Hsia, E Use of agonists of formyl peptide receptor 2 for treating dermatological diseases US Patent US10799518 Publication Date 10/13/2020 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
N-formyl peptide receptor 2 |
---|
Name: | N-formyl peptide receptor 2 |
Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38968.35 |
Organism: | Homo sapiens (Human) |
Description: | P25090 |
Residue: | 351 |
Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
BDBM350538 |
---|
n/a |
---|
Name | BDBM350538 |
Synonyms: | N-(4-bromophenyl)-1,3,3a,4,7,7a- hexahydro-1,3-dioxo-2H-isoindole-2- acetamide | US10208071, Table 3.14 | US10434112, Table 3.14 | US10799518, Structure TABLE 3.14 |
Type | Small organic molecule |
Emp. Form. | C16H15BrN2O3 |
Mol. Mass. | 363.206 |
SMILES | Brc1ccc(NC(=O)CN2C(=O)C3CC=CCC3C2=O)cc1 |c:14| |
Structure |
|