Reaction Details |
| Report a problem with these data |
Target | AP-4 complex subunit sigma-1 |
---|
Ligand | BDBM484127 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Human Sigma-1 Receptor Radioligand Assay |
---|
Ki | <100±n/a nM |
---|
Citation | Virgili-Bernado, M; Almansa-Rosales, C; Alegret-Molina, C Oxadiazaspiro compounds for the treatment of drug abuse and addiction US Patent US10927128 Publication Date 2/23/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
AP-4 complex subunit sigma-1 |
---|
Name: | AP-4 complex subunit sigma-1 |
Synonyms: | AP-4 complex subunit sigma-1 | AP4S1 | AP4S1_HUMAN | Sigma-1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 17000.04 |
Organism: | Homo sapiens (Human) |
Description: | Sigma-1 0 HUMAN::Q9Y587 |
Residue: | 144 |
Sequence: | MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYR
QYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILAPLLILDKMSES
|
|
|
BDBM484127 |
---|
n/a |
---|
Name | BDBM484127 |
Synonyms: | 9-(3,3-dimethylbutyl)-4- propyl-1-oxa-4,9- diazaspiro[5.5]undecan-3- one | US10927128, Example 48 | US11649248, Example 48 |
Type | Small organic molecule |
Emp. Form. | C17H32N2O2 |
Mol. Mass. | 296.4482 |
SMILES | CCCN1CC2(CCN(CCC(C)(C)C)CC2)OCC1=O |
Structure |
|