| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM497327 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TBD |
|---|
| IC50 | 3900±n/a nM |
|---|
| Citation |  Gangjee, A Pyrimidine compounds and pyrimido indole compounds and methods of use US Patent US11001595 Publication Date 5/11/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23415.37 |
|---|
| Organism: | Human pneumocystis pneumonia agent |
|---|
| Description: | A0A0W4ZHR8 |
|---|
| Residue: | 206 |
|---|
| Sequence: | MDWQKSLTLIVALTLSRGIGLKNDLPWKLKSDMMFFSRVTSGLLVTRSTGQMNVVLMGRK
TWESLPAHSRPLKNRINVVISRQEVLDLGGGAYHARSLDDALALLSQIYDSTSKIQLNRV
FVIGGGELYKAAMEHSRLNRIIATVIHNEVDCDVFFPIDFRSSQSCLPWRKQDHSVLEAW
VGSKVPQGKINENGFIYEFEMWIRDI
|
|
|
|---|
| BDBM497327 |
|---|
| n/a |
|---|
| Name | BDBM497327 |
|---|
| Synonyms: | US11001595, Compound 1 | US11001595, Compound 5 | US11111252, Compound 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H16N4O2S2 |
|---|
| Mol. Mass. | 348.443 |
|---|
| SMILES | COc1ccc(Sc2sc3nc(N)nc(N)c3c2C)cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
