Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | N-formyl peptide receptor 2 |
---|
Ligand | BDBM517736 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FPR2 and FPR1 Cyclic Adenosine Monophosphate (cAMP) Assays |
---|
EC50 | 675±n/a nM |
---|
Citation | Shirude, PS; Chattopadhyay, AK; Wurtz, NR Aryl heterocyclic piperidinone formyl peptide 2 receptor and formyl peptide 1 receptor agonists US Patent US11124494 Publication Date 9/21/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
N-formyl peptide receptor 2 |
---|
Name: | N-formyl peptide receptor 2 |
Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38968.35 |
Organism: | Homo sapiens (Human) |
Description: | P25090 |
Residue: | 351 |
Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
BDBM517736 |
---|
n/a |
---|
Name | BDBM517736 |
Synonyms: | (R)-1-(1-(4-(1- (morpholinomethyl) cyclopentyl) phenyl)-2- oxopiperidin-3-yl)- 3-(5- (trifluoromethyl) pyridin-2-yl)urea | US11124494, Example 65 |
Type | Small organic molecule |
Emp. Form. | C28H34F3N5O3 |
Mol. Mass. | 545.5965 |
SMILES | FC(F)(F)c1ccc(NC(=O)N[C@@H]2CCCN(C2=O)c2ccc(cc2)C2(CN3CCOCC3)CCCC2)nc1 |r| |
Structure |
|