| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-1 |
|---|
| Ligand | BDBM408768 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Determination of the IC50 for KLK1 |
|---|
| IC50 | >40000±n/a nM |
|---|
| Citation |  Davie, RL; Edwards, HJ; Evans, DM; Hodgson, ST; Pethen, SJ; Rooker, DP Pyrazole derivatives as plasma kallikrein inhibitors US Patent US11180484 Publication Date 11/23/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Kallikrein-1 |
|---|
| Name: | Kallikrein-1 |
|---|
| Synonyms: | KLK1 | KLK1_HUMAN | Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28874.69 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06870 |
|---|
| Residue: | 262 |
|---|
| Sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
|
|
|
|---|
| BDBM408768 |
|---|
| n/a |
|---|
| Name | BDBM408768 |
|---|
| Synonyms: | N-[(6-cyano-2-fluoro-3-methoxyphenyl)methyl]-3-(methoxymethyl)-1-({4-[(2- | US10364238, Example 77 | US10730874, Example 00398 | US11001578, Example 77 | US11084809, Example 77 | US11198691, Example 77 | US11352356, Table II.4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H26FN5O4 |
|---|
| Mol. Mass. | 515.5355 |
|---|
| SMILES | COCc1nn(Cc2ccc(Cn3ccccc3=O)cc2)cc1C(=O)NCc1c(F)c(OC)ccc1C#N |
|---|
| Structure | 
|
|---|
Search and Browse
