Reaction Details |
| Report a problem with these data |
Target | Elongin-B/Elongin-C [17-112]/von Hippel-Lindau disease tumor suppressor [55-213] |
---|
Ligand | BDBM536267 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescence Polarization (FP) VHL Binding Assay |
---|
IC50 | 47300±n/a nM |
---|
Citation | Blaquiere, N; Dragovich, P; Gazzard, LJ; Pillow, T; Staben, ST; Wei, B; Xin, J (4-hydroxypyrrolidin-2-yl)-heterocyclic compounds and methods of use thereof US Patent US11242344 Publication Date 2/8/2022 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Elongin-B/Elongin-C [17-112]/von Hippel-Lindau disease tumor suppressor [55-213] |
---|
Name: | Elongin-B/Elongin-C [17-112]/von Hippel-Lindau disease tumor suppressor [55-213] |
Synonyms: | VHL Elongin B/C complex |
Type: | Protein |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 3 components. |
Component 1 |
Name: | von Hippel-Lindau disease tumor suppressor [55-213] |
Synonyms: | VHL | VHL (aa 55-213) | VHL_HUMAN |
Type: | Protein |
Mol. Mass.: | 18405.28 |
Organism: | Homo sapiens (Human) |
Description: | P40337[55-213] |
Residue: | 159 |
Sequence: | EAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRG
HLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPEN
YRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
|
|
|
Component 2 |
Name: | Elongin-B |
Synonyms: | ELOB | ELOB_HUMAN | Elongin 18 kDa subunit | Elongin-B | RNA polymerase II transcription factor SIII subunit B | SIII p18 | TCEB2 | Transcription elongation factor B polypeptide 2 |
Type: | PROTEIN |
Mol. Mass.: | 13127.13 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_108414 |
Residue: | 118 |
Sequence: | MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
|
|
|
Component 3 |
Name: | Elongin-C [17-112] |
Synonyms: | ELOC | ELOC_HUMAN | TCEB1 | Transcription elongation factor B polypeptide 1 (aa 17-112) |
Type: | PROTEIN |
Mol. Mass.: | 10829.81 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 96 |
Sequence: | MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
|
|
|
BDBM536267 |
---|
n/a |
---|
Name | BDBM536267 |
Synonyms: | US11242344, Example 137.2 |
Type | Small organic molecule |
Emp. Form. | C15H22N4O5S |
Mol. Mass. | 370.424 |
SMILES | CC(C)[C@@H](C(=O)N1C[C@H](O)C[C@@H]1C1=NS(=O)(=O)CN1)c1cc(C)no1 |r,t:13| |
Structure |
|