Reaction Details |
| Report a problem with these data |
Target | Stimulator of interferon genes protein [139-328] |
---|
Ligand | BDBM564867 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Radiometric Filtration Binding Competition Assay |
---|
IC50 | >100000±n/a nM |
---|
Citation | Chamberlain, BT; Rice, JM; Jernigan, III, FE; Sherman, W; Kulkarni, MM; Shechter, S; Allen, BK; Tan, D; Marino, KA; Lin, Z Oxoacridinyl acetic acid derivatives and methods of use US Patent US11414387 Publication Date 8/16/2022 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Stimulator of interferon genes protein [139-328] |
---|
Name: | Stimulator of interferon genes protein [139-328] |
Synonyms: | Eris | Mita | Mpys | STING_MOUSE | Stimulator of interferon genes protein (STING)(139-328) | Sting | Sting1 | Tmem173 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 21484.24 |
Organism: | Mus musculus (Mouse) |
Description: | aa 139-328 |
Residue: | 190 |
Sequence: | TPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLY
ILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCIL
EYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTD
GNSFSLSQEV
|
|
|
BDBM564867 |
---|
n/a |
---|
Name | BDBM564867 |
Synonyms: | US11414387, Compound 21 |
Type | Small organic molecule |
Emp. Form. | C15H10BrNO3 |
Mol. Mass. | 332.149 |
SMILES | OC(=O)Cn1c2ccccc2c(=O)c2cc(Br)ccc12 |
Structure |
|