Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
---|
Ligand | BDBM8722 |
---|
Substrate/Competitor | Crotonoyl-ACP |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 6.5±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 93700±7800 nM |
---|
Citation | Miller, WH; Seefeld, MA; Newlander, KA; Uzinskas, IN; Burgess, WJ; Heerding, DA; Yuan, CC; Head, MS; Payne, DJ; Rittenhouse, SF; Moore, TD; Pearson, SC; Berry, V; DeWolf, WE; Keller, PM; Polizzi, BJ; Qiu, X; Janson, CA; Huffman, WF Discovery of aminopyridine-based inhibitors of bacterial enoyl-ACP reductase (FabI). J Med Chem45:3246-56 (2002) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
Synonyms: | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI | FABI_STAAR | NADPH-dependent enoyl-ACP reductase | fabI | trans-2-enoyl-[acyl carrier protein] reductase |
Type: | Enzyme |
Mol. Mass.: | 27989.00 |
Organism: | Staphylococcus aureus |
Description: | Q6GI75 |
Residue: | 256 |
Sequence: | MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
|
|
|
BDBM8722 |
---|
Crotonoyl-ACP |
---|
Name: | Crotonoyl-ACP |
Synonyms: | n/a |
Type: | Other Protein Type |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | 1. NAD(P)H is its co-substrate. 2. Crotonoyl-ACP was synthesized using ACP synthase to catalyse the addition of a crotonoyl group from crotonoyl-CoA to apo-ACP |
Residue: | 3 |
Sequence: | |