Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Tumor necrosis factor |
---|
Ligand | BDBM511477 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Kinase Activity Assay |
---|
IC50 | 71.0±n/a nM |
---|
Citation | deLong, MA; Carlson, E; Kopczynski, C; Sturdivant, JM; Lichorowic, C Isoquinoline-steroid conjugates and uses thereof US Patent US11691950 Publication Date 7/4/2023 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tumor necrosis factor |
---|
Name: | Tumor necrosis factor |
Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
Type: | Enzyme |
Mol. Mass.: | 25645.11 |
Organism: | Homo sapiens (Human) |
Description: | P01375 |
Residue: | 233 |
Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
BDBM511477 |
---|
n/a |
---|
Name | BDBM511477 |
Synonyms: | US11059789, Example 29 | US11691950, Example 29 |
Type | Small organic molecule |
Emp. Form. | C52H60FN3O12 |
Mol. Mass. | 938.0441 |
SMILES | CC(C)(C)OC(=O)NC[C@@H](C(=O)Nc1ccc2cnccc2c1)c1ccc(COC(=O)CCC(=O)OCC(=O)[C@@]23OC(C)(C)O[C@@H]2C[C@H]2[C@@H]4CCC5=CC(=O)C=C[C@]5(C)[C@@]4(F)[C@@H](O)C[C@]32C)cc1 |r,c:58,t:54| |
Structure |
|