| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-2 |
|---|
| Ligand | BDBM387281 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition of IL-2 secretion |
|---|
| IC50 | 550±n/a nM |
|---|
| Citation |  Irlapati, NR; Deshmukh, GK; Karche, VP; Jachak, SM; Sinha, N; Palle, VP; Kamboj, RK Oxazoline and isoxazoline derivatives as CRAC modulators US Patent US10292981 Publication Date 5/21/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-2 |
|---|
| Name: | Interleukin-2 |
|---|
| Synonyms: | IL-2 | IL2 | IL2_HUMAN | INN=Aldesleukin | Interleukin-2 | Interleukin-2 (IL-2) | T-cell growth factor | TCGF |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17630.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P60568 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
|
|
|
|---|
| BDBM387281 |
|---|
| n/a |
|---|
| Name | BDBM387281 |
|---|
| Synonyms: | N-(5-(5- (5,5-Dimethyl-4-oxo- 4,5-dihydroisoxazol- 3-yl)-2- methylphenyl)pyridin- 2-yl)-2,6- difluorobenzamide | US10292981, Example 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H19F2N3O3 |
|---|
| Mol. Mass. | 435.4228 |
|---|
| SMILES | Cc1ccc(cc1-c1ccc(NC(=O)c2c(F)cccc2F)nc1)C1=NOC(C)(C)C1=O |t:27| |
|---|
| Structure | 
|
|---|
Search and Browse
