Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cathepsin K |
---|
Ligand | BDBM150417 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay of Human Cathepsin K |
---|
pH | 3.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 2500±n/a nM |
---|
Comments | extracted |
---|
Citation | Anderskewitz, R; Binder, F; Grauert, M; Grundl, M; Haebel, PW; Oost, T; Pautsch, A; Peters, S; Vintonyak, V Methods for treating pulmonary emphysema using substituted 2-Aza-bicyclo[2.2.1]heptane-3-carboxylic acid (benzyl-cyano-methyl)-amides inhibitors of cathepsin C US Patent US9713606 Publication Date 7/25/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin K |
---|
Name: | Cathepsin K |
Synonyms: | CATK_HUMAN | CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X |
Type: | Enzyme |
Mol. Mass.: | 36975.68 |
Organism: | Homo sapiens (Human) |
Description: | P43235 |
Residue: | 329 |
Sequence: | MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
|
|
|
BDBM150417 |
---|
n/a |
---|
Name | BDBM150417 |
Synonyms: | US10238633, Example 91 | US8987249, 91 | US9713606, 91 |
Type | Small organic molecule |
Emp. Form. | C21H28FN5O3S |
Mol. Mass. | 449.542 |
SMILES | CS(=O)(=O)N1CCN(CC1)c1ccc(C[C@H](NC(=O)[C@H]2N[C@@H]3CC[C@H]2C3)C#N)c(F)c1 |r| |
Structure |
|