Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM35843 |
---|
Substrate/Competitor | BDBM10852 |
---|
Meas. Tech. | Radioligand Binding Assay |
---|
Ki | 90±n/a nM |
---|
Citation | Gillespie, RJ; Bamford, SJ; Clay, A; Gaur, S; Haymes, T; Jackson, PS; Jordan, AM; Klenke, B; Leonardi, S; Liu, J; Mansell, HL; Ng, S; Saadi, M; Simmonite, H; Stratton, GC; Todd, RS; Williamson, DS; Yule, IA Antagonists of the human A(2A) receptor. Part 6: Further optimization of pyrimidine-4-carboxamides. Bioorg Med Chem17:6590-605 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36520.92 |
Organism: | Homo sapiens (Human) |
Description: | P30542 |
Residue: | 326 |
Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
BDBM35843 |
---|
BDBM10852 |
---|
Name | BDBM35843 |
Synonyms: | pyrimidine-4-carboxamide, 28 |
Type | Small organic molecule |
Emp. Form. | C17H17N5O2 |
Mol. Mass. | 323.3492 |
SMILES | Cc1ccc(o1)-c1cc(nc(N)n1)C(=O)NCc1ncccc1C |
Structure |
|