Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM36787 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
IC50 | 52±0.0 nM |
---|
Citation | Chang, YT; Gray, NS; Rosania, GR; Sutherlin, DP; Kwon, S; Norman, TC; Sarohia, R; Leost, M; Meijer, L; Schultz, PG Synthesis and application of functionally diverse 2,6,9-trisubstituted purine libraries as CDK inhibitors. Chem Biol6:361-75 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM36787 |
---|
n/a |
---|
Name | BDBM36787 |
Synonyms: | 2-(1 R-isopropyl-2-hydroxyethylamino)-9-isopropylpurine core C6-substituent, 98 |
Type | Small organic molecule |
Emp. Form. | C19H28ClN7O |
Mol. Mass. | 405.925 |
SMILES | CC(C)[C@H](CO)Nc1nc2N(CNc2c(Nc2ccc(Cl)c(N)c2)n1)C(C)C |r| |
Structure |
|