Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM1079 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
Ki | 0.49±n/a nM |
---|
Citation | De Lucca, GV; Liang, J; De Lucca, I Stereospecific synthesis, structure-activity relationship, and oral bioavailability of tetrahydropyrimidin-2-one HIV protease inhibitors. J Med Chem42:135-52 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM1079 |
---|
n/a |
---|
Name | BDBM1079 |
Synonyms: | (4R,5R,6R)-4-benzyl-5-hydroxy-1,3-bis({[3-(hydroxymethyl)phenyl]methyl})-6-(2-phenylethyl)-1,3-diazinan-2-one | (4R,5R,6R)-Tetrahydro-1,3-bis[[3-(hydroxymethyl)phenyl]methyl]-5-hydroxy-4-(2-phenylethyl)-6-(phenylmethyl)-2(1H)-pyrimidinone | Tetrahydropyrimidinone deriv. 21 |
Type | Small organic molecule |
Emp. Form. | C35H38N2O4 |
Mol. Mass. | 550.6872 |
SMILES | OCc1cccc(CN2[C@H](CCc3ccccc3)[C@@H](O)[C@@H](Cc3ccccc3)N(Cc3cccc(CO)c3)C2=O)c1 |r| |
Structure |
|