Reaction Details |
| Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM403758 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition of Tautomerase Activity of Human MIF |
---|
Ki | 64000±n/a nM |
---|
Citation | Jorgensen, WL; Dziedzic, P; Cisneros, J Biaryltriazole inhibitors of macrophage migration inhibitory factor US Patent US10336721 Publication Date 7/2/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM403758 |
---|
n/a |
---|
Name | BDBM403758 |
Synonyms: | US10336721, Example 15 | US10968198, Example 15 |
Type | Small organic molecule |
Emp. Form. | C20H17FN4O2 |
Mol. Mass. | 364.373 |
SMILES | COCCOc1cccc2ccc(nc12)-c1cn(nn1)-c1ccc(F)cc1 |
Structure |
|