| Reaction Details |
|---|
 | Report a problem with these data |
| Target | GTPase KRas [1-37] |
|---|
| Ligand | BDBM43231 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Multiplexed dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Ras wildtype |
|---|
| EC50 | 4033±n/a nM |
|---|
| Citation |  PubChem, PC Multiplexed dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Ras wildtype PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| GTPase KRas [1-37] |
|---|
| Name: | GTPase KRas [1-37] |
|---|
| Synonyms: | ras protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 4034.04 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_190938 |
|---|
| Residue: | 37 |
|---|
| Sequence: | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIE
|
|
|
|---|
| BDBM43231 |
|---|
| n/a |
|---|
| Name | BDBM43231 |
|---|
| Synonyms: | (E)-3-(1-benzyl-3-thiophen-2-ylpyrazol-4-yl)prop-2-enoic acid | (E)-3-[1-(phenylmethyl)-3-thiophen-2-yl-4-pyrazolyl]-2-propenoic acid | (E)-3-[1-(phenylmethyl)-3-thiophen-2-yl-pyrazol-4-yl]prop-2-enoic acid | (E)-3-[1-benzyl-3-(2-thienyl)pyrazol-4-yl]acrylic acid | MLS001002570 | SMR000369092 | cid_2554530 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H14N2O2S |
|---|
| Mol. Mass. | 310.37 |
|---|
| SMILES | OC(=O)\C=C\c1cn(Cc2ccccc2)nc1-c1cccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
