| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Ligand | BDBM43634 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response cell-based assay to measure STAT3 activation |
|---|
| IC50 | 1298±n/a nM |
|---|
| Citation |  PubChem, PC Dose response cell-based assay to measure STAT3 activation PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Name: | Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Synonyms: | APRF | STAT3 | STAT3_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 5263.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_13272532 |
|---|
| Residue: | 50 |
|---|
| Sequence: | AAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNGEGAEPSAGGQF
|
|
|
|---|
| BDBM43634 |
|---|
| n/a |
|---|
| Name | BDBM43634 |
|---|
| Synonyms: | 2-methyl-N-[4-[(o-anisoylamino)carbamoyl]phenyl]propionamide | MLS000672334 | N-(4-{[2-(2-methoxybenzoyl)hydrazino]carbonyl}phenyl)-2-methylpropanamide | N-[4-[[(2-methoxybenzoyl)amino]carbamoyl]phenyl]-2-methylpropanamide | N-[4-[[(2-methoxyphenyl)carbonylamino]carbamoyl]phenyl]-2-methyl-propanamide | N-[4-[[[(2-methoxyphenyl)-oxomethyl]hydrazo]-oxomethyl]phenyl]-2-methylpropanamide | SMR000295764 | cid_1242183 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H21N3O4 |
|---|
| Mol. Mass. | 355.3877 |
|---|
| SMILES | COc1ccccc1C(=O)NNC(=O)c1ccc(NC(=O)C(C)C)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
