Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Signal transducer and activator of transcription 3 [702-738,740-752] |
---|
Ligand | BDBM43504 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response counterscreen for STAT1 inhibitors: cell-based high throughput assay to measure STAT3 inhibition |
---|
IC50 | >55700±n/a nM |
---|
Citation | PubChem, PC Dose response counterscreen for STAT1 inhibitors: cell-based high throughput assay to measure STAT3 inhibition PubChem Bioassay(2008)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Signal transducer and activator of transcription 3 [702-738,740-752] |
---|
Name: | Signal transducer and activator of transcription 3 [702-738,740-752] |
Synonyms: | APRF | STAT3 | STAT3_HUMAN |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 5263.93 |
Organism: | Homo sapiens (Human) |
Description: | gi_13272532 |
Residue: | 50 |
Sequence: | AAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNGEGAEPSAGGQF
|
|
|
BDBM43504 |
---|
n/a |
---|
Name | BDBM43504 |
Synonyms: | 5-amino-3-(2-methylphenyl)-1,2-oxazole-4-carbonitrile | 5-amino-3-(2-methylphenyl)-4-isoxazolecarbonitrile | 5-amino-3-(2-methylphenyl)isoxazole-4-carbonitrile | 5-amino-3-(o-tolyl)isoxazole-4-carbonitrile | 5-azanyl-3-(2-methylphenyl)-1,2-oxazole-4-carbonitrile | MLS000045809 | SMR000028206 | cid_3236239 |
Type | Small organic molecule |
Emp. Form. | C11H9N3O |
Mol. Mass. | 199.2087 |
SMILES | Cc1ccccc1-c1noc(N)c1C#N |
Structure |
|