Reaction Details |
| Report a problem with these data |
Target | Beta-lactamase |
---|
Ligand | BDBM51987 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FRET-based counterscreen for selective VIM-2 inhibitors: dose response biochemical high throughput screening assay to identify inhibitors of IMP-1 metallo-beta-lactamase. |
---|
IC50 | 59640±n/a nM |
---|
Citation | PubChem, PC FRET-based counterscreen for selective VIM-2 inhibitors: dose response biochemical high throughput screening assay to identify inhibitors of IMP-1 metallo-beta-lactamase. PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Beta-lactamase |
---|
Name: | Beta-lactamase |
Synonyms: | Beta-lactamase | metallo-beta-lactamase IMP-1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 27125.88 |
Organism: | Pseudomonas aeruginosa |
Description: | gi_27368096 |
Residue: | 246 |
Sequence: | MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA
EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT
NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP
YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
PSKPSN
|
|
|
BDBM51987 |
---|
n/a |
---|
Name | BDBM51987 |
Synonyms: | MLS000624309 | N-[5-[2-(furan-2-ylmethylamino)-2-oxidanylidene-ethyl]sulfanyl-1,3,4-thiadiazol-2-yl]cyclohexanecarboxamide | N-[5-[2-(furan-2-ylmethylamino)-2-oxoethyl]sulfanyl-1,3,4-thiadiazol-2-yl]cyclohexanecarboxamide | N-[5-[[2-(2-furanylmethylamino)-2-oxoethyl]thio]-1,3,4-thiadiazol-2-yl]cyclohexanecarboxamide | N-[5-[[2-(2-furfurylamino)-2-keto-ethyl]thio]-1,3,4-thiadiazol-2-yl]cyclohexanecarboxamide | SMR000323623 | cid_7190957 |
Type | Small organic molecule |
Emp. Form. | C16H20N4O3S2 |
Mol. Mass. | 380.485 |
SMILES | O=C(CSc1nnc(NC(=O)C2CCCCC2)s1)NCc1ccco1 |
Structure |
|