Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Tumor necrosis factor |
---|
Ligand | BDBM62249 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | SAR analysis of inhibitors of TNFa specific NF-kB induction revised |
---|
IC50 | 584±n/a nM |
---|
Citation | PubChem, PC SAR analysis of inhibitors of TNFa specific NF-kB induction revised PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Tumor necrosis factor |
---|
Name: | Tumor necrosis factor |
Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
Type: | Enzyme |
Mol. Mass.: | 25645.11 |
Organism: | Homo sapiens (Human) |
Description: | P01375 |
Residue: | 233 |
Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
BDBM62249 |
---|
n/a |
---|
Name | BDBM62249 |
Synonyms: | 1-[5-[4-(4-chlorophenyl)piperazin-1-yl]sulfonyl-2-methyl-2,3-dihydroindol-1-yl]propan-1-one | 1-[5-[4-(4-chlorophenyl)piperazino]sulfonyl-2-methyl-indolin-1-yl]propan-1-one | 1-[5-[[4-(4-chlorophenyl)-1-piperazinyl]sulfonyl]-2-methyl-2,3-dihydroindol-1-yl]-1-propanone | MLS-0412138.0001 | cid_44182143 |
Type | Small organic molecule |
Emp. Form. | C22H26ClN3O3S |
Mol. Mass. | 447.978 |
SMILES | CCC(=O)N1C(C)Cc2cc(ccc12)S(=O)(=O)N1CCN(CC1)c1ccc(Cl)cc1 |
Structure |
|