Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM54805 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | SAR Analysis of Agonists of the DOR Receptor using an Image-Based Assay |
---|
EC50 | >32000±n/a nM |
---|
Citation | PubChem, PC SAR Analysis of Agonists of the DOR Receptor using an Image-Based Assay PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM54805 |
---|
n/a |
---|
Name | BDBM54805 |
Synonyms: | (phenylmethyl) N-[1-[[2,6-bis(chloranyl)phenyl]carbamothioylamino]-2,2,2-tris(chloranyl)ethyl]carbamate | MLS000561692 | N-[2,2,2-trichloro-1-[(2,6-dichlorophenyl)thiocarbamoylamino]ethyl]carbamic acid benzyl ester | N-[2,2,2-trichloro-1-[[(2,6-dichloroanilino)-sulfanylidenemethyl]amino]ethyl]carbamic acid (phenylmethyl) ester | SMR000173875 | benzyl N-[2,2,2-trichloro-1-[(2,6-dichlorophenyl)carbamothioylamino]ethyl]carbamate | cid_3091265 | {2,2,2-Trichloro-1-[3-(2,6-dichloro-phenyl)-thioureido]-ethyl}-carbamic acid benzyl ester |
Type | Small organic molecule |
Emp. Form. | C17H14Cl5N3O2S |
Mol. Mass. | 501.642 |
SMILES | Clc1cccc(Cl)c1NC(=S)NC(NC(=O)OCc1ccccc1)C(Cl)(Cl)Cl |
Structure |
|