Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
---|
Ligand | BDBM61226 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) |
---|
IC50 | 67047±n/a nM |
---|
Citation | PubChem, PC Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
---|
Name: | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
Synonyms: | PP-1A | PP1A_HUMAN | PPP1A | PPP1CA | Serine/threonine protein phosphatase PP1-alpha catalytic subunit | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit | protein phosphatase 1, catalytic subunit, alpha isoform 3 |
Type: | PROTEIN |
Mol. Mass.: | 37510.66 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_197827 |
Residue: | 330 |
Sequence: | MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
|
|
|
BDBM61226 |
---|
n/a |
---|
Name | BDBM61226 |
Synonyms: | 3,4-dimethyl-N-[2-oxidanyl-1,3-bis(oxidanylidene)inden-2-yl]benzamide | MLS000830217 | N-(2-hydroxy-1,3-diketo-indan-2-yl)-3,4-dimethyl-benzamide | N-(2-hydroxy-1,3-dioxo-2,3-dihydro-1H-inden-2-yl)-3,4-dimethylbenzamide | N-(2-hydroxy-1,3-dioxo-2-indenyl)-3,4-dimethylbenzamide | N-(2-hydroxy-1,3-dioxoinden-2-yl)-3,4-dimethylbenzamide | SMR000458138 | cid_2810379 |
Type | Small organic molecule |
Emp. Form. | C18H15NO4 |
Mol. Mass. | 309.316 |
SMILES | Cc1ccc(cc1C)C(=O)NC1(O)C(=O)c2ccccc2C1=O |
Structure |
|