| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor |
|---|
| Ligand | BDBM30719 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | HTS dose response assay for identification of inhibitors of TNFa-specific NF-kB induction |
|---|
| IC50 | 3373.5±441.5 nM |
|---|
| Citation |  PubChem, PC HTS dose response assay for identification of inhibitors of TNFa-specific NF-kB induction PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tumor necrosis factor |
|---|
| Name: | Tumor necrosis factor |
|---|
| Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25645.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01375 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
|---|
| BDBM30719 |
|---|
| n/a |
|---|
| Name | BDBM30719 |
|---|
| Synonyms: | (3E)-6-hexyl-3-[(5E)-5-(6-ketocyclohexa-2,4-dien-1-ylidene)-1,3,4-oxadiazolidin-2-ylidene]chromene-2,7-quinone | (3E)-6-hexyl-3-[(5E)-5-(6-oxidanylidenecyclohexa-2,4-dien-1-ylidene)-1,3,4-oxadiazolidin-2-ylidene]chromene-2,7-dione | (3E)-6-hexyl-3-[(5E)-5-(6-oxo-1-cyclohexa-2,4-dienylidene)-1,3,4-oxadiazolidin-2-ylidene]-1-benzopyran-2,7-dione | (3E)-6-hexyl-3-[(5E)-5-(6-oxocyclohexa-2,4-dien-1-ylidene)-1,3,4-oxadiazolidin-2-ylidene]chromene-2,7-dione | MLS000079474 | SMR000036273 | cid_5389090 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22N2O5 |
|---|
| Mol. Mass. | 406.4312 |
|---|
| SMILES | CCCCCCC1=Cc2c\c(=C3\NN\C(O3)=C3\C=CC=CC3=O)c(=O)oc2=CC1=O |c:18,20,29,t:6| |
|---|
| Structure | 
|
|---|
Search and Browse
