| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glycogen synthase kinase-3 beta |
|---|
| Ligand | BDBM69208 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Luminescence Cell-Free Homogeneous Dose Retest to Identify Inhibitors of Glycogen Synthase Kinase-3 beta Activity |
|---|
| EC50 | >300000±n/a nM |
|---|
| Citation |  PubChem, PC Luminescence Cell-Free Homogeneous Dose Retest to Identify Inhibitors of Glycogen Synthase Kinase-3 beta Activity PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Glycogen synthase kinase-3 beta |
|---|
| Name: | Glycogen synthase kinase-3 beta |
|---|
| Synonyms: | GSK-3 beta | GSK-3, beta | GSK3B | GSK3B_HUMAN | Glycogen synthase kinase 3 beta (GSK3B) | Glycogen synthase kinase 3-beta (GSK3B) | Glycogen synthase kinase-3 beta (GSK-3B) | Glycogen synthase kinase-3 beta (GSK3 Beta) | Glycogen synthase kinase-3 beta (GSK3B) | Glycogen synthase kinase-3B (GSK-3B) | Glycogen synthase kinase-3beta (GSK3B) | Serine/threonine-protein kinase GSK3B |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 46756.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P49841 |
|---|
| Residue: | 420 |
|---|
| Sequence: | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
|
|
|
|---|
| BDBM69208 |
|---|
| n/a |
|---|
| Name | BDBM69208 |
|---|
| Synonyms: | 2-[(2-keto-5-methoxy-indol-3-yl)amino]isoindoline-1,3-quinone | 2-[(5-methoxy-2-oxidanylidene-indol-3-yl)amino]isoindole-1,3-dione | 2-[(5-methoxy-2-oxo-1,2-dihydro-3H-indol-3-ylidene)amino]-1H-isoindole-1,3(2H)-dione | 2-[(5-methoxy-2-oxo-3-indolyl)amino]isoindole-1,3-dione | 2-[(5-methoxy-2-oxoindol-3-yl)amino]isoindole-1,3-dione | MLS000681089 | SMR000269355 | cid_880314 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H11N3O4 |
|---|
| Mol. Mass. | 321.2869 |
|---|
| SMILES | COc1ccc2=NC(=O)C(NN3C(=O)c4ccccc4C3=O)=c2c1 |c:23,t:5| |
|---|
| Structure | 
|
|---|
Search and Browse
