| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein Rev |
|---|
| Ligand | BDBM50755 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of gld-1: Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of the HIV Rev protein-RRE RNA interaction |
|---|
| IC50 | 20324±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of gld-1: Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of the HIV Rev protein-RRE RNA interaction PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Protein Rev |
|---|
| Name: | Protein Rev |
|---|
| Synonyms: | Human immunodeficiency virus type 1 REV | REV_HV1H2 | rev |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13078.11 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_79479 |
|---|
| Residue: | 116 |
|---|
| Sequence: | MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIL
GTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
|
|
|
|---|
| BDBM50755 |
|---|
| n/a |
|---|
| Name | BDBM50755 |
|---|
| Synonyms: | 4-(3-Cyano-6-ethoxy-quinolin-2-yl)-[1,4]diazepane-1-carboxylic acid o-tolylamide | 4-(3-cyano-6-ethoxy-2-quinolinyl)-N-(2-methylphenyl)-1,4-diazepane-1-carboxamide | 4-(3-cyano-6-ethoxy-2-quinolyl)-N-(o-tolyl)-1,4-diazepane-1-carboxamide | 4-(3-cyano-6-ethoxy-quinolin-2-yl)-N-(2-methylphenyl)-1,4-diazepane-1-carboxamide | 4-(3-cyano-6-ethoxyquinolin-2-yl)-N-(2-methylphenyl)-1,4-diazepane-1-carboxamide | MLS000074436 | SMR000006841 | cid_647185 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H27N5O2 |
|---|
| Mol. Mass. | 429.5142 |
|---|
| SMILES | CCOc1ccc2nc(N3CCCN(CC3)C(=O)Nc3ccccc3C)c(cc2c1)C#N |
|---|
| Structure | 
|
|---|
Search and Browse
