Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Mitochondrial import inner membrane translocase subunit TIM10 |
---|
Ligand | BDBM49152 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of uHTS small molecule inhibitors of tim10-1 yeast via a luminescent assay |
---|
IC50 | 18000±n/a nM |
---|
Citation | PubChem, PC Dose Response confirmation of uHTS small molecule inhibitors of tim10-1 yeast via a luminescent assay PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Mitochondrial import inner membrane translocase subunit TIM10 |
---|
Name: | Mitochondrial import inner membrane translocase subunit TIM10 |
Synonyms: | MRS11 | TIM10 | TIM10_YEAST | TPA: Essential protein of the mitochondrial intermembrane space | TPA: Essential protein of the mitochondrial intermembrane space, forms a complex with Tim9p (TIM10 complex) that delivers hydrophobic proteins to the TIM22 complex for insertion into the inner ... |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 10303.50 |
Organism: | Saccharomyces cerevisiae S288c |
Description: | gi_285809906 |
Residue: | 93 |
Sequence: | MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESS
CLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF
|
|
|
BDBM49152 |
---|
n/a |
---|
Name | BDBM49152 |
Synonyms: | 5-chloranyl-7-[(4-ethylpiperazin-1-yl)-pyridin-3-yl-methyl]quinolin-8-ol | 5-chloro-7-[(4-ethyl-1-piperazinyl)-(3-pyridinyl)methyl]-8-quinolinol | 5-chloro-7-[(4-ethylpiperazin-1-yl)-pyridin-3-ylmethyl]quinolin-8-ol | 5-chloro-7-[(4-ethylpiperazino)-(3-pyridyl)methyl]quinolin-8-ol | BRD4354 | MLS000564806 | SMR000151966 | cid_3516032 |
Type | Small organic molecule |
Emp. Form. | C21H23ClN4O |
Mol. Mass. | 382.887 |
SMILES | CCN1CCN(CC1)C(c1cccnc1)c1cc(Cl)c2cccnc2c1O |
Structure |
|