| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Caspase-3 |
|---|
| Ligand | BDBM79431 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response counterscreen for dual activators of procaspase-3 and procaspase-7: Absorbance-based biochemical high throughput screening assay to identify activators of procaspase-3 |
|---|
| EC50 | >85236±n/a nM |
|---|
| Citation |  PubChem, PC Dose response counterscreen for dual activators of procaspase-3 and procaspase-7: Absorbance-based biochemical high throughput screening assay to identify activators of procaspase-3 PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Caspase-3 |
|---|
| Name: | Caspase-3 |
|---|
| Synonyms: | Apopain | CASP-3 | CASP3 | CASP3_HUMAN | CPP-32 | CPP32 | Caspase 3 | Caspase-3 subunit p12 | Caspase-3 subunit p17 | Cysteine protease CPP32 | SCA-1 | SREBP cleavage activity 1 | Yama protein | caspase-3 preproprotein |
|---|
| Type: | Hydrolase; heterotetramer of two heterodimers |
|---|
| Mol. Mass.: | 31607.55 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 277 |
|---|
| Sequence: | MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
|
|
|
|---|
| BDBM79431 |
|---|
| n/a |
|---|
| Name | BDBM79431 |
|---|
| Synonyms: | MLS000519824 | SMR000130242 | [4-(4-fluorophenyl)-1-piperazinyl]-[1-(4-methoxyanilino)-4-isoquinolinyl]methanone | [4-(4-fluorophenyl)piperazin-1-yl]-[1-(4-methoxyanilino)isoquinolin-4-yl]methanone | [4-(4-fluorophenyl)piperazin-1-yl]-[1-[(4-methoxyphenyl)amino]isoquinolin-4-yl]methanone | [4-(4-fluorophenyl)piperazino]-[1-(p-anisidino)-4-isoquinolyl]methanone | cid_9550319 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H25FN4O2 |
|---|
| Mol. Mass. | 456.5114 |
|---|
| SMILES | COc1ccc(Nc2ncc(C(=O)N3CCN(CC3)c3ccc(F)cc3)c3ccccc23)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
