Reaction Details |
| Report a problem with these data |
Target | Cholecystokinin |
---|
Ligand | BDBM82386 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1100±n/a nM |
---|
Comments | PDSP_16 |
---|
Citation | Evans, BE; Bock, MG; Rittle, KE; DiPardo, RM; Whitter, WL; Veber, DF; Anderson, PS; Freidinger, RM Design of potent, orally effective, nonpeptidal antagonists of the peptide hormone cholecystokinin. Proc Natl Acad Sci U S A83:4918-22 (1986) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Cholecystokinin |
---|
Name: | Cholecystokinin |
Synonyms: | CCKN_RAT | Cck |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 12844.29 |
Organism: | RAT |
Description: | Cholecystokinin 0 RAT::P01355 |
Residue: | 115 |
Sequence: | MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA
LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
|
|
|
BDBM82386 |
---|
n/a |
---|
Name | BDBM82386 |
Synonyms: | CCK antagonist synthetic 15 |
Type | n/a |
Emp. Form. | C25H19FN4O2 |
Mol. Mass. | 426.4424 |
SMILES | Cc1ccc2c(c[nH]c2c1)C(=O)NC1N=C(c2ccccc2F)c2ccccc2NC1=O |t:16| |
Structure |
|