| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50281388 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1722785 (CHEMBL4137785) |
|---|
| Ki | 326±n/a nM |
|---|
| Citation |  Bautista-Aguilera, ÓM; Budni, J; Mina, F; Medeiros, EB; Deuther-Conrad, W; Entrena, JM; Moraleda, I; Iriepa, I; López-Muñoz, F; Marco-Contelles, J Contilisant, a Tetratarget Small Molecule for Alzheimer's Disease Therapy Combining Cholinesterase, Monoamine Oxidase Inhibition, and H3R Antagonism with S1R Agonism Profile. J Med Chem61:6937-6943 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50281388 |
|---|
| n/a |
|---|
| Name | BDBM50281388 |
|---|
| Synonyms: | CHEMBL4173258 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H31N3O |
|---|
| Mol. Mass. | 353.501 |
|---|
| SMILES | CN(CC#C)Cc1cc2cc(OCCCN3CCCCC3)ccc2n1C |
|---|
| Structure | 
|
|---|
Search and Browse
