Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50219754 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1733120 |
---|
Ki | 13±n/a nM |
---|
Citation | Sun, YT; Wang, GF; Yang, YQ; Jin, F; Wang, Y; Xie, XY; Mach, RH; Huang, YS Synthesis and pharmacological evaluation of 6,7-dimethoxy-1,2,3,4-tetrahydroisoquinoline derivatives as sigma-2 receptor ligands. Eur J Med Chem147:227-237 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20857.20 |
Organism: | Homo sapiens (Human) |
Description: | Q5BJF2 |
Residue: | 176 |
Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
BDBM50219754 |
---|
n/a |
---|
Name | BDBM50219754 |
Synonyms: | 1-cyclohexyl-4-[3-(9H-carbazol-9-yl)propyl]piperazine hydrochloride | CHEMBL536305 |
Type | Small organic molecule |
Emp. Form. | C25H33N3 |
Mol. Mass. | 375.5496 |
SMILES | C(CN1CCN(CC1)C1CCCCC1)Cn1c2ccccc2c2ccccc12 |
Structure |
|