Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protein lin-28 homolog A |
---|
Ligand | BDBM50348824 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1734969 (CHEMBL4150505) |
---|
IC50 | 2300±n/a nM |
---|
Citation | Lorenz, DA; Kaur, T; Kerk, SA; Gallagher, EE; Sandoval, J; Garner, AL Expansion of cat-ELCCA for the Discovery of Small Molecule Inhibitors of the Pre-let-7-Lin28 RNA-Protein Interaction. ACS Med Chem Lett9:517-521 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein lin-28 homolog A |
---|
Name: | Protein lin-28 homolog A |
Synonyms: | LN28A_MOUSE | Lin-28A | Lin28 | Lin28a | Protein lin-28 homolog A | Testis-expressed protein 17 | Tex17 |
Type: | PROTEIN |
Mol. Mass.: | 22729.80 |
Organism: | Mus musculus |
Description: | ChEMBL_118142 |
Residue: | 209 |
Sequence: | MGSVSNQQFAGGCAKAAEKAPEEAPPDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS
ERRPKGKNMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQQ
GPSSQGKPAYFREEEEEIHSPALLPEAQN
|
|
|
BDBM50348824 |
---|
n/a |
---|
Name | BDBM50348824 |
Synonyms: | CHEMBL4177195 |
Type | Small organic molecule |
Emp. Form. | C20H18Cl2N2O4S2 |
Mol. Mass. | 485.404 |
SMILES | Cc1ccc(cc1Cl)S(=O)(=O)Nc1ccccc1NS(=O)(=O)c1ccc(C)c(Cl)c1 |
Structure |
|