Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50056919 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1736785 (CHEMBL4152535) |
---|
IC50 | 1150±n/a nM |
---|
Citation | Khan, H; Rengasamy, KRR; Pervaiz, A; Nabavi, SM; Atanasov, AG; Kamal, MA Plant-derived mPGES-1 inhibitors or suppressors: A new emerging trend in the search for small molecules to combat inflammation. Eur J Med Chem153:2-28 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50056919 |
---|
n/a |
---|
Name | BDBM50056919 |
Synonyms: | 3-hydroxy-4-(methoxycarbonyl)-2,5-dimethylphenyl 3-formyl-2,4-dihydroxy-6-methylbenzoate | ATRANORIN | CHEMBL173395 | NSC-685591 | methyl 1-(3-formyl-2,4-dihydroxy-6-methylphenylcarbonyloxy)-3-hydroxy-2,5-dimethyl-4-benzenecarboxylate |
Type | Small organic molecule |
Emp. Form. | C19H18O8 |
Mol. Mass. | 374.3414 |
SMILES | COC(=O)c1c(C)cc(OC(=O)c2c(C)cc(O)c(C=O)c2O)c(C)c1O |
Structure |
|