Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Melatonin receptor type 1B |
---|
Ligand | BDBM50458978 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1765188 (CHEMBL4200435) |
---|
Ki | 4.6±n/a nM |
---|
Citation | Spadoni, G; Bedini, A; Furiassi, L; Mari, M; Mor, M; Scalvini, L; Lodola, A; Ghidini, A; Lucini, V; Dugnani, S; Scaglione, F; Piomelli, D; Jung, KM; Supuran, CT; Lucarini, L; Durante, M; Sgambellone, S; Masini, E; Rivara, S Identification of Bivalent Ligands with Melatonin Receptor Agonist and Fatty Acid Amide Hydrolase (FAAH) Inhibitory Activity That Exhibit Ocular Hypotensive Effect in the Rabbit. J Med Chem61:7902-7916 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melatonin receptor type 1B |
---|
Name: | Melatonin receptor type 1B |
Synonyms: | MTNR1B | MTR1B_HUMAN | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2) |
Type: | Enzyme |
Mol. Mass.: | 40203.54 |
Organism: | Homo sapiens (Human) |
Description: | P49286 |
Residue: | 362 |
Sequence: | MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
|
|
|
BDBM50458978 |
---|
n/a |
---|
Name | BDBM50458978 |
Synonyms: | CHEMBL4214478 |
Type | Small organic molecule |
Emp. Form. | C31H35N3O4 |
Mol. Mass. | 513.6273 |
SMILES | CC(=O)NCCc1c[nH]c2ccc(OCCCCCCNC(=O)Oc3cccc(c3)-c3ccccc3)cc12 |
Structure |
|