Reaction Details |
| Report a problem with these data |
Target | Matrix protein 2 |
---|
Ligand | BDBM50465108 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1784202 (CHEMBL4255719) |
---|
IC50 | 4000±n/a nM |
---|
Citation | Drakopoulos, A; Tzitzoglaki, C; McGuire, K; Hoffmann, A; Konstantinidi, A; Kolokouris, D; Ma, C; Freudenberger, K; Hutterer, J; Gauglitz, G; Wang, J; Schmidtke, M; Busath, DD; Kolocouris, A Unraveling the Binding, Proton Blockage, and Inhibition of Influenza M2 WT and S31N by Rimantadine Variants. ACS Med Chem Lett9:198-203 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Matrix protein 2 |
---|
Name: | Matrix protein 2 |
Synonyms: | M | M2_I72A8 | Proton channel protein M2 |
Type: | PROTEIN |
Mol. Mass.: | 11180.06 |
Organism: | Influenza A virus (A/Udorn/307/1972(H3N2)) |
Description: | ChEMBL_22 |
Residue: | 97 |
Sequence: | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK
RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE
|
|
|
BDBM50465108 |
---|
n/a |
---|
Name | BDBM50465108 |
Synonyms: | CHEMBL4277543 |
Type | Small organic molecule |
Emp. Form. | C13H23N |
Mol. Mass. | 193.3284 |
SMILES | CC(C)(N)C12CC3CC(CC(C3)C1)C2 |TLB:7:8:12:5.6.11,THB:7:6:12:13.8.9,9:8:5:12.10.11,9:10:5:13.8.7| |
Structure |
|