| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50368642 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_527308 (CHEMBL971950) |
|---|
| IC50 | 232±n/a nM |
|---|
| Citation |  Ma, C; Nakamura, N; Hattori, M; Kakuda, H; Qiao, J; Yu, H Inhibitory effects on HIV-1 protease of constituents from the wood of Xanthoceras sorbifolia. J Nat Prod63:238-42 (2000) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50368642 |
|---|
| n/a |
|---|
| Name | BDBM50368642 |
|---|
| Synonyms: | ACETYLPEPSTATIN |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H57N5O9 |
|---|
| Mol. Mass. | 643.8124 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(C)=O)C(C)C)C(C)C)[C@@H](O)CC(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
