Reaction Details |
| Report a problem with these data |
Target | DNA-binding transcriptional activator DevR/DosR |
---|
Ligand | BDBM50480870 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_591901 (CHEMBL1050034) |
---|
IC50 | 248000±n/a nM |
---|
Citation | Gupta, RK; Thakur, TS; Desiraju, GR; Tyagi, JS Structure-based design of DevR inhibitor active against nonreplicating Mycobacterium tuberculosis. J Med Chem52:6324-34 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
DNA-binding transcriptional activator DevR/DosR |
---|
Name: | DNA-binding transcriptional activator DevR/DosR |
Synonyms: | DEVR_MYCTU | DNA-binding transcriptional activator DevR/DosR | devR | dosR |
Type: | PROTEIN |
Mol. Mass.: | 23292.23 |
Organism: | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Description: | ChEMBL_102872 |
Residue: | 217 |
Sequence: | MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDG
NGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGA
GRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKT
VKNYVSRLLAKLGMERRTQAAVFATELKRSRPPGDGP
|
|
|
BDBM50480870 |
---|
n/a |
---|
Name | BDBM50480870 |
Synonyms: | CHEMBL571713 |
Type | Small organic molecule |
Emp. Form. | C25H25Cl2NO5 |
Mol. Mass. | 490.376 |
SMILES | COc1cc(NC(=O)CCc2ccc(OCc3ccc(Cl)cc3)c(OC)c2)c(OC)cc1Cl |
Structure |
|