Reaction Details |
| Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50485180 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_821526 (CHEMBL2038194) |
---|
IC50 | 950±n/a nM |
---|
Citation | Pawar, SA; Jabgunde, AM; Govender, P; Maguire, GE; Kruger, HG; Parboosing, R; Soliman, ME; Sayed, Y; Dhavale, DD; Govender, T Synthesis and molecular modelling studies of novel carbapeptide analogs for inhibition of HIV-1 protease. Eur J Med Chem53:13-21 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50485180 |
---|
n/a |
---|
Name | BDBM50485180 |
Synonyms: | CHEMBL2035865 |
Type | Small organic molecule |
Emp. Form. | C18H31N3O8 |
Mol. Mass. | 417.454 |
SMILES | [H][C@]12OC([C@H](N)CC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O)[C@H](O)[C@@]1([H])OC(C)(C)O2 |r| |
Structure |
|