| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50029533 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_76105 (CHEMBL684606) |
|---|
| IC50 | 33400±n/a nM |
|---|
| Citation |  Romines, KR; Watenpaugh, KD; Howe, WJ; Tomich, PK; Lovasz, KD; Morris, JK; Janakiraman, MN; Lynn, JC; Horng, MM; Chong, KT Structure-based design of nonpeptidic HIV protease inhibitors from a cyclooctylpyranone lead structure. J Med Chem38:4463-73 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50029533 |
|---|
| n/a |
|---|
| Name | BDBM50029533 |
|---|
| Synonyms: | (2-{3-[Cyclopropyl-(4-hydroxy-2-oxo-5,6,7,8,9,10-hexahydro-2H-cycloocta[b]pyran-3-yl)-methyl]-phenylcarbamoyl}-ethyl)-carbamic acid tert-butyl ester | CHEMBL16359 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H38N2O6 |
|---|
| Mol. Mass. | 510.6218 |
|---|
| SMILES | CC(C)(C)OC(=O)NCCC(=O)Nc1cccc(c1)C(C1CC1)c1c(O)c2CCCCCCc2oc1=O |
|---|
| Structure | 
|
|---|
Search and Browse
